Lineage for d1yitj1 (1yit J:4-145)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691478Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 691479Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 691480Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 691481Protein Ribosomal protein L13 [52163] (2 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 691482Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries)
  8. 691492Domain d1yitj1: 1yit J:4-145 [123350]
    Other proteins in same PDB: d1yit11, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yith1, d1yiti1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yitx1, d1yity1, d1yitz1
    automatically matched to d1ffkg_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3, vir, vrs

Details for d1yitj1

PDB Entry: 1yit (more details), 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (J:) 50S ribosomal protein L13P

SCOP Domain Sequences for d1yitj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yitj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1yitj1:

Click to download the PDB-style file with coordinates for d1yitj1.
(The format of our PDB-style files is described here.)

Timeline for d1yitj1: