Lineage for d1yite1 (1yit E:1-79)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734251Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 734252Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 734253Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 734254Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 734255Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
  8. 734274Domain d1yite1: 1yit E:1-79 [123345]
    Other proteins in same PDB: d1yit11, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yitf1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yitx1, d1yity1, d1yitz1
    automatically matched to d1ffk11
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3, vir, vrs

Details for d1yite1

PDB Entry: 1yit (more details), 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1yite1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yite1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1yite1:

Click to download the PDB-style file with coordinates for d1yite1.
(The format of our PDB-style files is described here.)

Timeline for d1yite1: