Lineage for d1yitd1 (1yit D:10-174)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420405Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 1420406Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 1420407Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 1420408Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 1420449Species Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
    Uniprot P14124
  8. 1420467Domain d1yitd1: 1yit D:10-174 [123344]
    Other proteins in same PDB: d1yit11, d1yit21, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yitx1, d1yity1, d1yitz1
    automatically matched to d1ffkd_
    complexed with cd, cl, k, mg, na, vir

Details for d1yitd1

PDB Entry: 1yit (more details), 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d1yitd1:

Sequence, based on SEQRES records: (download)

>d1yitd1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1yitd1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOPe Domain Coordinates for d1yitd1:

Click to download the PDB-style file with coordinates for d1yitd1.
(The format of our PDB-style files is described here.)

Timeline for d1yitd1: