![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein Response regulatory protein StyR, N-terminal domain [142027] (1 species) |
![]() | Species Pseudomonas fluorescens [TaxId:294] [142028] (2 PDB entries) Uniprot O30989 3-130 |
![]() | Domain d1yioa2: 1yio A:3-130 [123327] Other proteins in same PDB: d1yioa1 complexed with hg, mg |
PDB Entry: 1yio (more details), 2.2 Å
SCOPe Domain Sequences for d1yioa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} akptvfvvdddmsvreglrnllrsagfevetfdcastflehrrpeqhgclvldmrmpgms gielqeqltaisdgipivfitahgdipmtvramkagaieflpkpfeeqalldaieqglql naerrqar
Timeline for d1yioa2: