SCOP 1.73: Domain d1yioa1: 1yio A:131-200

Lineage for d1yioa1 (1yio A:131-200)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
   contains additional, fourth helix in the C-terminal extension

6. Protein Response regulatory protein StyR, C-terminal domain [140317] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [140318] (2 PDB entries)

8. Domain d1yioa1: 1yio A:131-200 [123326]
   Other proteins in same PDB: d1yioa2
   complexed with hg, mg

Details for d1yioa1

PDB Entry: 1yio, 2.2 Å

PDB Description: Crystallographic structure of response regulator StyR from Pseudomonas fluorescens

PDB Compounds: (A:) response regulatory protein

SCOP Domain Sequences for d1yioa1:

Sequence; same for both SEQRES and ATOM records:

>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]}
etqdqleqlfssltgreqqvlqltirglmnkqiagelgiaevtvkvhrhnimqklnvrsl
anlvhlveky

Timeline for d1yioa1:

• d1yioa1 is new in SCOP 1.73
  
• d1yioa1 appears in SCOP 1.75
  
• d1yioa1 appears in the current release, SCOPe 2.08