SCOPe 2.08: Domain d1yijz1: 1yij Z:10-82

Lineage for d1yijz1 (1yij Z:10-82)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
   automatically mapped to Pfam PF01780

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
   Uniprot P60619

8. Domain d1yijz1: 1yij Z:10-82 [123323]
   Other proteins in same PDB: d1yij11, d1yij21, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijg1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1
   automatically matched to d1s72z_
   complexed with cd, cl, k, mg, na, tel; mutant

Details for d1yijz1

PDB Entry: 1yij, 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d1yijz1:

Sequence; same for both SEQRES and ATOM records:

>d1yijz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

Timeline for d1yijz1:

• d1yijz1 first appeared in SCOP 1.73
  
• d1yijz1 appears in SCOPe 2.07