Lineage for d1yijw1 (1yij W:1-154)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726215Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 726216Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 726217Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 726218Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 726219Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
  8. 726245Domain d1yijw1: 1yij W:1-154 [123320]
    Other proteins in same PDB: d1yij11, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijx1, d1yijy1, d1yijz1
    automatically matched to d1ffkt_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, tel, ur3; mutant

Details for d1yijw1

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOP Domain Sequences for d1yijw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yijw1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOP Domain Coordinates for d1yijw1:

Click to download the PDB-style file with coordinates for d1yijw1.
(The format of our PDB-style files is described here.)

Timeline for d1yijw1: