Lineage for d1yij11 (1yij 1:1-56)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751154Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
  6. 751155Protein Ribosomal protein L37e [57834] (1 species)
  7. 751156Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
  8. 751182Domain d1yij11: 1yij 1:1-56 [123295]
    Other proteins in same PDB: d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
    automatically matched to d1ffkx_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, tel, ur3; mutant

Details for d1yij11

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOP Domain Sequences for d1yij11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yij11 g.41.8.2 (1:1-56) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOP Domain Coordinates for d1yij11:

Click to download the PDB-style file with coordinates for d1yij11.
(The format of our PDB-style files is described here.)

Timeline for d1yij11: