Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (20 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
Domain d1yiec1: 1yie C:2-136 [123281] Other proteins in same PDB: d1yieb1, d1yied1 automatically matched to d1abwa1 complexed with hem, oxy; mutant |
PDB Entry: 1yie (more details), 2.4 Å
SCOP Domain Sequences for d1yiec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yiec1 a.1.1.2 (C:2-136) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} lspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgkk vadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpav hasldkflasvstvl
Timeline for d1yiec1: