Class g: Small proteins [56992] (85 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (3 families) |
Family g.7.1.1: Snake venom toxins [57303] (27 proteins) |
Protein alpha-Cobratoxin [57318] (2 species) |
Species Cobra (Naja siamensis) [TaxId:84476] [57319] (3 PDB entries) |
Domain d1yi5j1: 1yi5 J:1-68 [123265] Other proteins in same PDB: d1yi5a1, d1yi5b1, d1yi5c1, d1yi5d1, d1yi5e1 automatically matched to d1ctx__ |
PDB Entry: 1yi5 (more details), 4.2 Å
SCOP Domain Sequences for d1yi5j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yi5j1 g.7.1.1 (J:1-68) alpha-Cobratoxin {Cobra (Naja siamensis) [TaxId: 84476]} ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd ncnpfptr
Timeline for d1yi5j1: