Class b: All beta proteins [48724] (165 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (1 family) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (1 protein) |
Protein Acetylcholine binding protein (ACHBP) [63714] (1 species) |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (5 PDB entries) |
Domain d1yi5d1: 1yi5 D:2-205 [123259] Other proteins in same PDB: d1yi5f1, d1yi5g1, d1yi5h1, d1yi5i1, d1yi5j1 automatically matched to d1uw6a_ |
PDB Entry: 1yi5 (more details), 4.2 Å
SCOP Domain Sequences for d1yi5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yi5d1 b.96.1.1 (D:2-205) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn svtysccpeayedvevslnfrkkg
Timeline for d1yi5d1: