Lineage for d1yi2n1 (1yi2 N:1-186)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 702503Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 702504Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 702505Protein Ribosomal protein L18 (L18p) [53139] (3 species)
  7. 702506Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
  8. 702513Domain d1yi2n1: 1yi2 N:1-186 [123243]
    Other proteins in same PDB: d1yi211, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1ffkk_
    complexed with 1ma, cd, cl, ery, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yi2n1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (N:) 50S ribosomal protein L18P

SCOP Domain Sequences for d1yi2n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2n1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1yi2n1:

Click to download the PDB-style file with coordinates for d1yi2n1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2n1: