Lineage for d1yi2a2 (1yi2 A:1-90)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1125083Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 1125121Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
    Uniprot P20276
    includes the N-terminal tail
  8. 1125133Domain d1yi2a2: 1yi2 A:1-90 [123230]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1s72a2
    complexed with cd, cl, ery, k, mg, na; mutant

Details for d1yi2a2

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d1yi2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

SCOPe Domain Coordinates for d1yi2a2:

Click to download the PDB-style file with coordinates for d1yi2a2.
(The format of our PDB-style files is described here.)

Timeline for d1yi2a2: