SCOP 1.73: Domain d1yhya3: 1yhy A:460-667

Lineage for d1yhya3 (1yhy A:460-667)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [88758] (2 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142208] (6 PDB entries)

8. Domain d1yhya3: 1yhy A:460-667 [123217]
   Other proteins in same PDB: d1yhya1, d1yhya2
   automatically matched to 1YBH A:460-667
   complexed with 1mm, fad, mg, nhe, p22

Details for d1yhya3

PDB Entry: 1yhy, 2.7 Å

PDB Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With A Sulfonylurea Herbicide, Metsulfuron methyl

PDB Compounds: (A:) Acetolactate synthase

SCOP Domain Sequences for d1yhya3:

Sequence; same for both SEQRES and ATOM records:

>d1yhya3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
eaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwlssgglgamgfglpa
aigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnqhlgmvmqwedrfy
kanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiqtmldtpgpylldv
icphqehvlpmipsggtfndvitegdgr

Timeline for d1yhya3:

• d1yhya3 is new in SCOP 1.73
  
• d1yhya3 appears in SCOP 1.75
  
• d1yhya3 appears in the current release, SCOPe 2.08