Lineage for d1yhya1 (1yhy A:281-459)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2470886Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2470887Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)
  7. 2470916Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142123] (12 PDB entries)
    Uniprot P17597 281-459
  8. 2470920Domain d1yhya1: 1yhy A:281-459 [123215]
    Other proteins in same PDB: d1yhya2, d1yhya3
    automated match to d1ybha1
    complexed with 1mm, fad, mg, nhe, p22

Details for d1yhya1

PDB Entry: 1yhy (more details), 2.7 Å

PDB Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With A Sulfonylurea Herbicide, Metsulfuron methyl
PDB Compounds: (A:) Acetolactate synthase

SCOPe Domain Sequences for d1yhya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhya1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
pkppedshleqivrliseskkpvlyvgggclnssdelgrfveltgipvastlmglgsypc
ddelslhmlgmhgtvyanyavehsdlllafgvrfddrvtgkleafasrakivhididsae
igknktphvsvcgdvklalqgmnkvlenraeelkldfgvwrnelnvqkqkfplsfktfg

SCOPe Domain Coordinates for d1yhya1:

Click to download the PDB-style file with coordinates for d1yhya1.
(The format of our PDB-style files is described here.)

Timeline for d1yhya1: