SCOP 1.75: Domain d1yhqv1: 1yhq V:1-65

Lineage for d1yhqv1 (1yhq V:1-65)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
   Uniprot P10971

8. Domain d1yhqv1: 1yhq V:1-65 [123204]
   Other proteins in same PDB: d1yhq11, d1yhq21, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqe1, d1yhqe2, d1yhqf1, d1yhqg1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
   automatically matched to d1ffks_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3, zit; mutant

Details for d1yhqv1

PDB Entry: 1yhq, 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (V:) 50S ribosomal protein L29P

SCOP Domain Sequences for d1yhqv1:

Sequence; same for both SEQRES and ATOM records:

>d1yhqv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1yhqv1:

• d1yhqv1 first appeared in SCOP 1.73
  
• d1yhqv1 appears in SCOPe 2.01
  
• d1yhqv1 appears in the current release, SCOPe 2.08