Lineage for d1yhqe1 (1yhq E:1-79)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873695Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 873696Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 873697Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 873698Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 873699Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 873716Domain d1yhqe1: 1yhq E:1-79 [123187]
    Other proteins in same PDB: d1yhq11, d1yhq21, d1yhq31, d1yhqa1, d1yhqa2, d1yhqb1, d1yhqc1, d1yhqd1, d1yhqf1, d1yhqg1, d1yhqh1, d1yhqi1, d1yhqj1, d1yhqk1, d1yhql1, d1yhqm1, d1yhqn1, d1yhqo1, d1yhqp1, d1yhqq1, d1yhqr1, d1yhqs1, d1yhqt1, d1yhqu1, d1yhqv1, d1yhqw1, d1yhqx1, d1yhqy1, d1yhqz1
    automatically matched to d1ffk11
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, sr, ur3, zit; mutant

Details for d1yhqe1

PDB Entry: 1yhq (more details), 2.4 Å

PDB Description: crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1yhqe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhqe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1yhqe1:

Click to download the PDB-style file with coordinates for d1yhqe1.
(The format of our PDB-style files is described here.)

Timeline for d1yhqe1: