SCOPe 2.03: Domain d1yhna1: 1yhn A:7-182

Lineage for d1yhna1 (1yhn A:7-182)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab7 [110540] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142230] (2 PDB entries)
   Uniprot P51149 7-182

8. Domain d1yhna1: 1yhn A:7-182 [123178]
   Other proteins in same PDB: d1yhnb1
   automatically matched to 1T91 A:7-182
   complexed with gtp, mg

Details for d1yhna1

PDB Entry: 1yhn, 3 Å

PDB Description: structure basis of rilp recruitment by rab7

PDB Compounds: (A:) Ras-related protein Rab-7

SCOPe Domain Sequences for d1yhna1:

Sequence; same for both SEQRES and ATOM records:

>d1yhna1 c.37.1.8 (A:7-182) Rab7 {Human (Homo sapiens) [TaxId: 9606]}
vllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdtag
lerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnk
idlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetevel

Timeline for d1yhna1:

• d1yhna1 first appeared in SCOP 1.73
  
• d1yhna1 appears in SCOPe 2.02
  
• d1yhna1 is called d1yhna_ in SCOPe 2.04
  
• d1yhna1 appears in the current release, SCOPe 2.08, called d1yhna_