SCOPe 2.08: Domain d1yhfa1: 1yhf A:1-112

Lineage for d1yhfa1 (1yhf A:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.9: TM1287-like [89409] (5 proteins)

6. Protein Hypothetical protein SPy1581 [141591] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [141592] (1 PDB entry)
   Uniprot Q99YR1 1-112

8. Domain d1yhfa1: 1yhf A:1-112 [123176]
   Other proteins in same PDB: d1yhfa2

Details for d1yhfa1

PDB Entry: 1yhf, 2 Å

PDB Description: Crystal Structure of Conserved SPY1581 Protein of Unknown Function from Streptococcus pyogenes

PDB Compounds: (A:) hypothetical protein SPy1581

SCOPe Domain Sequences for d1yhfa1:

Sequence; same for both SEQRES and ATOM records:

>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]}
msyinniehakvldltqevmieqdqmlsrtlvqrqdlgitvfsldkgqeigrhsspgdam
vtilsglaeitidqetyrvaegqtivmpagiphalyaveafqmllvvvkpea

Timeline for d1yhfa1:

• d1yhfa1 first appeared in SCOP 1.73
  
• d1yhfa1 appears in SCOPe 2.07