Class a: All alpha proteins [46456] (258 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (22 species) |
Species Human (Homo sapiens) [TaxId:9606] [46501] (173 PDB entries) |
Domain d1yh9b1: 1yh9 B:1-146 [123165] Other proteins in same PDB: d1yh9a1, d1yh9c1 automatically matched to d1dxtb_ complexed with hem, oxy |
PDB Entry: 1yh9 (more details), 2.2 Å
SCOP Domain Sequences for d1yh9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yh9b1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1yh9b1: