Class g: Small proteins [56992] (85 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Coagulation factor VIIa [57201] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57202] (19 PDB entries) |
Domain d1ygcl1: 1ygc L:90-142 [123143] Other proteins in same PDB: d1ygch1 automatically matched to d1klil_ complexed with 905, ca, so4 |
PDB Entry: 1ygc (more details), 2 Å
SCOP Domain Sequences for d1ygcl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ygcl1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile
Timeline for d1ygcl1: