Lineage for d1yg8e1 (1yg8 E:15-193)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690607Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein)
  6. 690608Protein Clp protease, ClpP subunit [52098] (5 species)
  7. 690609Species Escherichia coli [TaxId:562] [52099] (4 PDB entries)
  8. 690656Domain d1yg8e1: 1yg8 E:15-193 [123118]
    automatically matched to d1tyfa_
    mutant

Details for d1yg8e1

PDB Entry: 1yg8 (more details), 2.6 Å

PDB Description: the structure of a v6a variant of clpp.
PDB Compounds: (E:) ATP-dependent Clp protease proteolytic subunit

SCOP Domain Sequences for d1yg8e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yg8e1 c.14.1.1 (E:15-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]}
rsfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggvitagm
siydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyqgqatd
ieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsilthrn

SCOP Domain Coordinates for d1yg8e1:

Click to download the PDB-style file with coordinates for d1yg8e1.
(The format of our PDB-style files is described here.)

Timeline for d1yg8e1: