Lineage for d1yfia1 (1yfi A:1-262)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835443Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 835444Superfamily c.52.1: Restriction endonuclease-like [52980] (33 families) (S)
  5. 835719Family c.52.1.23: Restriction endonuclease MspI [110624] (1 protein)
  6. 835720Protein Restriction endonuclease MspI [110625] (1 species)
  7. 835721Species Moraxella sp. [TaxId:479] [110626] (2 PDB entries)
    Uniprot P11405
  8. 835724Domain d1yfia1: 1yfi A:1-262 [123068]
    automatically matched to d1sa3a_

Details for d1yfia1

PDB Entry: 1yfi (more details), 2.7 Å

PDB Description: Crystal Structure of restriction endonuclease MspI in complex with its cognate DNA in P212121 space group
PDB Compounds: (A:) Type II restriction enzyme MspI

SCOP Domain Sequences for d1yfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfia1 c.52.1.23 (A:1-262) Restriction endonuclease MspI {Moraxella sp. [TaxId: 479]}
mrtellsklyddfgidqlphtqhgvtsdrlgklyekyildifkdieslkkyntnafpqek
disskllkalnldldniidvsssdtdlgrtiaggspktdatirftfhnqssrlvplnikh
sskkkvsiaeydvetictgvgisdgelkelirkhqndqsaklftpvqkqrltellepyre
rfirwcvtlraeksegnilhpdllirfqvidreyvdvtikniddyvsdriaegskarkpg
fgtglnwtyasgskakkmqfkg

SCOP Domain Coordinates for d1yfia1:

Click to download the PDB-style file with coordinates for d1yfia1.
(The format of our PDB-style files is described here.)

Timeline for d1yfia1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yfib1