Lineage for d1yfhc2 (1yfh C:5-91)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1375137Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families) (S)
  5. 1375138Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)
  6. 1375142Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)
  7. 1375143Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries)
    Uniprot P16455 6-176
  8. 1375150Domain d1yfhc2: 1yfh C:5-91 [123067]
    Other proteins in same PDB: d1yfha1, d1yfhb1, d1yfhc1
    automatically matched to d1eh6a2
    protein/DNA complex; complexed with zn

Details for d1yfhc2

PDB Entry: 1yfh (more details), 3.01 Å

PDB Description: wt Human O6-Alkylguanine-DNA Alkyltransferase Bound To DNA Containing an Alkylated Cytosine
PDB Compounds: (C:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1yfhc2:

Sequence, based on SEQRES records: (download)

>d1yfhc2 c.55.7.1 (C:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqcta
wlnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records): (download)

>d1yfhc2 c.55.7.1 (C:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheikllggpeplmqctawlnayfhqpeaieefpvpa
lhhpvfqq

SCOPe Domain Coordinates for d1yfhc2:

Click to download the PDB-style file with coordinates for d1yfhc2.
(The format of our PDB-style files is described here.)

Timeline for d1yfhc2: