SCOP 1.73: Domain d1yfhb1: 1yfh B:92-175

Lineage for d1yfhb1 (1yfh B:92-175)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (1 family)

5. Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins)

6. Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46772] (7 PDB entries)

8. Domain d1yfhb1: 1yfh B:92-175 [123064]
   Other proteins in same PDB: d1yfha2, d1yfhb2, d1yfhc2
   automatically matched to d1eh6a1
   complexed with xcy, zn

Details for d1yfhb1

PDB Entry: 1yfh, 3.01 Å

PDB Description: wt Human O6-Alkylguanine-DNA Alkyltransferase Bound To DNA Containing an Alkylated Cytosine

PDB Compounds: (B:) methylated-DNA--protein-cysteine methyltransferase

SCOP Domain Sequences for d1yfhb1:

Sequence; same for both SEQRES and ATOM records:

>d1yfhb1 a.4.2.1 (B:92-175) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs
sgavgnysgglavkewllaheghr

Timeline for d1yfhb1:

• d1yfhb1 is new in SCOP 1.73
  
• d1yfhb1 appears in SCOP 1.75
  
• d1yfhb1 appears in the current release, SCOPe 2.08