![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (1 family) ![]() |
![]() | Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins) |
![]() | Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries) Uniprot P16455 6-176 |
![]() | Domain d1yfha2: 1yfh A:5-91 [123063] Other proteins in same PDB: d1yfha1, d1yfhb1, d1yfhc1 automatically matched to d1eh6a2 protein/DNA complex; complexed with zn |
PDB Entry: 1yfh (more details), 3.01 Å
SCOPe Domain Sequences for d1yfha2:
Sequence, based on SEQRES records: (download)
>d1yfha2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]} cemkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqcta wlnayfhqpeaieefpvpalhhpvfqq
>d1yfha2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]} cemkrttldsplgklelsgceqglheikllgvpapaavlggpeplmqctawlnayfhqpe aieefpvpalhhpvfqq
Timeline for d1yfha2:
![]() Domains from other chains: (mouse over for more information) d1yfhb1, d1yfhb2, d1yfhc1, d1yfhc2 |