SCOPe 2.01: Domain d1yfha1: 1yfh A:92-179

Lineage for d1yfha1 (1yfh A:92-179)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (1 family)

5. Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins)

6. Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46772] (7 PDB entries)
   Uniprot P16455 6-176

8. Domain d1yfha1: 1yfh A:92-179 [123062]
   Other proteins in same PDB: d1yfha2, d1yfhb2, d1yfhc2
   automatically matched to d1eh6a1
   protein/DNA complex; complexed with zn

Details for d1yfha1

PDB Entry: 1yfh, 3.01 Å

PDB Description: wt Human O6-Alkylguanine-DNA Alkyltransferase Bound To DNA Containing an Alkylated Cytosine

PDB Compounds: (A:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1yfha1:

Sequence; same for both SEQRES and ATOM records:

>d1yfha1 a.4.2.1 (A:92-179) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs
sgavgnysgglavkewllaheghrlgkp

Timeline for d1yfha1:

• d1yfha1 first appeared in SCOP 1.73
  
• d1yfha1 appears in SCOP 1.75
  
• d1yfha1 appears in SCOPe 2.02
  
• d1yfha1 appears in the current release, SCOPe 2.08