Lineage for d1yfea1 (1yfe A:4-459)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777280Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 777281Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 777282Family a.127.1.1: L-aspartase/fumarase [48558] (5 proteins)
  6. 777354Protein Fumarase [48561] (3 species)
  7. 777357Species Escherichia coli [TaxId:562] [48562] (7 PDB entries)
  8. 777368Domain d1yfea1: 1yfe A:4-459 [123061]
    automatically matched to d1fuob_
    mutant

Details for d1yfea1

PDB Entry: 1yfe (more details), 2.19 Å

PDB Description: crystal structure of apo fumarase c from escherichia coli
PDB Compounds: (A:) fumarate hydratase class II

SCOP Domain Sequences for d1yfea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfea1 a.127.1.1 (A:4-459) Fumarase {Escherichia coli [TaxId: 562]}
vrsekdsmgaidvpadklwgaqtqrslehfristekmptslihalaltkraaakvnedlg
llseekasairqaadevlagqhddefplaiwqtgsgtqsnmnmnevlanrasellggvrg
merkvhpnddvnksqssndvfptamhvaallalrkqlipqlktltqtlneksrafadivk
igrthlqdatpltlgqeisgwvamlehnlkhieyslphvaelalggtavgtglnthpeya
rrvadelavitcapfvtapnkfealatcdalvqahgalkglaaslmkiandvrwlasgpr
cgigeisipenepgssimpgkvnptqcealtmlccqvmgndvainmggasgnfelnvfrp
mvihnflqsvrlladgmesfnkhcavgiepnrerinqllneslmlvtalnthigydkaae
iakkahkegltlkaaalalgylseaefdswvrpeqm

SCOP Domain Coordinates for d1yfea1:

Click to download the PDB-style file with coordinates for d1yfea1.
(The format of our PDB-style files is described here.)

Timeline for d1yfea1: