SCOP 1.73: Domain d1yfdb1: 1yfd B:1-340

Lineage for d1yfdb1 (1yfd B:1-340)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (8 species)

7. Species Escherichia coli [TaxId:562] [47258] (23 PDB entries)

8. Domain d1yfdb1: 1yfd B:1-340 [123060]
   automatically matched to 1YFD A:1-340
   complexed with f2o, hg; mutant

Details for d1yfdb1

PDB Entry: 1yfd, 1.9 Å

PDB Description: crystal structure of the y122h mutant of ribonucleotide reductase r2 protein from e. coli

PDB Compounds: (B:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOP Domain Sequences for d1yfdb1:

Sequence; same for both SEQRES and ATOM records:

>d1yfdb1 a.25.1.2 (B:1-340) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
shthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv

Timeline for d1yfdb1:

• d1yfdb1 is new in SCOP 1.73
  
• d1yfdb1 appears in SCOP 1.75
  
• d1yfdb1 appears in the current release, SCOPe 2.08, called d1yfdb_