SCOPe 2.06: Domain d1yfda1: 1yfd A:1-340

Lineage for d1yfda1 (1yfd A:1-340)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (10 species)

7. Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)

8. Domain d1yfda1: 1yfd A:1-340 [123059]
   complexed with feo, hg; mutant

Details for d1yfda1

PDB Entry: 1yfd, 1.9 Å

PDB Description: crystal structure of the y122h mutant of ribonucleotide reductase r2 protein from e. coli

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOPe Domain Sequences for d1yfda1:

Sequence; same for both SEQRES and ATOM records:

>d1yfda1 a.25.1.2 (A:1-340) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
shthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv

Timeline for d1yfda1:

• d1yfda1 first appeared in SCOP 1.73
  
• d1yfda1 appears in SCOPe 2.05
  
• d1yfda1 appears in SCOPe 2.07
  
• d1yfda1 appears in the current release, SCOPe 2.08