Lineage for d1yf9c_ (1yf9 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898507Protein automated matches [190124] (12 species)
    not a true protein
  7. 1898601Species Leishmania major [TaxId:5664] [188133] (1 PDB entry)
  8. 1898603Domain d1yf9c_: 1yf9 C: [123056]
    Other proteins in same PDB: d1yf9a1
    automated match to d1yf9a1
    complexed with cl

Details for d1yf9c_

PDB Entry: 1yf9 (more details), 2 Å

PDB Description: Structural analysis of Leishmania major ubiquitin conjugating enzyme E2
PDB Compounds: (C:) Ubiquitin carrier protein 4

SCOPe Domain Sequences for d1yf9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yf9c_ d.20.1.1 (C:) automated matches {Leishmania major [TaxId: 5664]}
snrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfksp
sigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnvqa
ahllhadrvgfdallrehvsthatpqkalesipeayrph

SCOPe Domain Coordinates for d1yf9c_:

Click to download the PDB-style file with coordinates for d1yf9c_.
(The format of our PDB-style files is described here.)

Timeline for d1yf9c_: