SCOPe 2.02: Domain d1yf9b_: 1yf9 B:

Lineage for d1yf9b_ (1yf9 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (11 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [188133] (1 PDB entry)

8. Domain d1yf9b_: 1yf9 B: [123055]
   Other proteins in same PDB: d1yf9a1
   automated match to d1yf9a1
   complexed with cl

Details for d1yf9b_

PDB Entry: 1yf9, 2 Å

PDB Description: Structural analysis of Leishmania major ubiquitin conjugating enzyme E2

PDB Compounds: (B:) Ubiquitin carrier protein 4

SCOPe Domain Sequences for d1yf9b_:

Sequence; same for both SEQRES and ATOM records:

>d1yf9b_ d.20.1.1 (B:) automated matches {Leishmania major [TaxId: 5664]}
lrsnrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfk
spsigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnv
qaahllhadrvgfdallrehvsthatpqkalesipeayrp

Timeline for d1yf9b_:

• d1yf9b_ first appeared in SCOP 1.73, called d1yf9b1
  
• d1yf9b_ appears in SCOPe 2.01
  
• d1yf9b_ appears in SCOPe 2.03
  
• d1yf9b_ appears in the current release, SCOPe 2.08