Lineage for d1yf9a1 (1yf9 A:13-170)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720007Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 720015Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)
  7. 720123Species Leishmania major [TaxId:5664] [143049] (1 PDB entry)
    Ubiquitin carrier protein 4, putative
  8. 720124Domain d1yf9a1: 1yf9 A:13-170 [123054]
    complexed with cl

Details for d1yf9a1

PDB Entry: 1yf9 (more details), 2 Å

PDB Description: Structural analysis of Leishmania major ubiquitin conjugating enzyme E2
PDB Compounds: (A:) Ubiquitin carrier protein 4

SCOP Domain Sequences for d1yf9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]}
snrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfksp
sigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnvqa
ahllhadrvgfdallrehvsthatpqkalesipeayrp

SCOP Domain Coordinates for d1yf9a1:

Click to download the PDB-style file with coordinates for d1yf9a1.
(The format of our PDB-style files is described here.)

Timeline for d1yf9a1: