Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50517] (23 PDB entries) |
Domain d1yf4a1: 1yf4 A:16-245 [123048] automatically matched to d1avwa_ complexed with ca, nh2 |
PDB Entry: 1yf4 (more details), 1.98 Å
SCOP Domain Sequences for d1yf4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yf4a1 b.47.1.2 (A:16-245) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
Timeline for d1yf4a1: