SCOPe 2.07: Domain d1yeod_: 1yeo D:

Lineage for d1yeod_ (1yeo D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (284 PDB entries)
   Uniprot P68871

8. Domain d1yeod_: 1yeo D: [123015]
   Other proteins in same PDB: d1yeoa_, d1yeoc_
   automated match to d1a01b_
   complexed with hem, oxy

Details for d1yeod_

PDB Entry: 1yeo, 2.22 Å

PDB Description: t-to-t(high) quaternary transitions in human hemoglobin: betaw37a oxy (10 test sets)

PDB Compounds: (D:) hemoglobin beta chain

SCOPe Domain Sequences for d1yeod_:

Sequence; same for both SEQRES and ATOM records:

>d1yeod_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypatqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1yeod_:

• d1yeod_ first appeared in SCOP 1.73, called d1yeod1
  
• d1yeod_ appears in SCOPe 2.06
  
• d1yeod_ appears in the current release, SCOPe 2.08