Lineage for d1ycjb1 (1ycj B:430-546,B:667-799)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846193Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)
  6. 846372Protein Glutamate receptor ligand binding core [53881] (4 species)
  7. 846509Species Rat (Rattus norvegicus), GluR5 [TaxId:10116] [142802] (6 PDB entries)
    Uniprot P22756 429-546,667-799! Uniprot P22756 433-544,682-815
  8. 846517Domain d1ycjb1: 1ycj B:430-546,B:667-799 [122967]
    automatically matched to 1YCJ A:429-546,A:667-799
    complexed with glu, so4

Details for d1ycjb1

PDB Entry: 1ycj (more details), 1.95 Å

PDB Description: crystal structure of the kainate receptor glur5 ligand-binding core in complex with (s)-glutamate
PDB Compounds: (B:) Ionotropic glutamate receptor 5

SCOP Domain Sequences for d1ycjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycjb1 c.94.1.1 (B:430-546,B:667-799) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]}
anrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgky
gaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtXpi
dsaddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrv
lttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqee
gklhmmkekww

SCOP Domain Coordinates for d1ycjb1:

Click to download the PDB-style file with coordinates for d1ycjb1.
(The format of our PDB-style files is described here.)

Timeline for d1ycjb1: