Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
Protein Nitric oxide reductase C-terminal domain [142047] (2 species) |
Species Moorella thermoacetica [TaxId:1525] [142048] (3 PDB entries) Uniprot Q9FDN7 251-399 |
Domain d1ychb1: 1ych B:251-399 [122959] Other proteins in same PDB: d1ycha2, d1ychb2, d1ychc2, d1ychd2 automated match to d1ycfa1 complexed with feo, fmn, zn |
PDB Entry: 1ych (more details), 2.8 Å
SCOPe Domain Sequences for d1ychb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ychb1 c.23.5.1 (B:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep gptvqwvprgedlqrcyelgrkiaariad
Timeline for d1ychb1: