Lineage for d1ybha3 (1ybh A:460-667)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694852Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 694853Protein Acetohydroxyacid synthase catalytic subunit [88758] (2 species)
  7. 694869Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142208] (6 PDB entries)
  8. 694870Domain d1ybha3: 1ybh A:460-667 [122893]
    Other proteins in same PDB: d1ybha1, d1ybha2
    complexed with cie, fad, mg, nhe, p22

Details for d1ybha3

PDB Entry: 1ybh (more details), 2.5 Å

PDB Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With A Sulfonylurea Herbicide Chlorimuron Ethyl
PDB Compounds: (A:) Acetolactate synthase, chloroplast

SCOP Domain Sequences for d1ybha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
eaippqyaikvldeltdgkaiistgvgqhqmwaaqfynykkprqwlssgglgamgfglpa
aigasvanpdaivvdidgdgsfimnvqelatirvenlpvkvlllnnqhlgmvmqwedrfy
kanrahtflgdpaqedeifpnmllfaaacgipaarvtkkadlreaiqtmldtpgpylldv
icphqehvlpmipsggtfndvitegdgr

SCOP Domain Coordinates for d1ybha3:

Click to download the PDB-style file with coordinates for d1ybha3.
(The format of our PDB-style files is described here.)

Timeline for d1ybha3: