Lineage for d1yarm1 (1yar M:1-203)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735943Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 736244Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 736253Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56253] (4 PDB entries)
  8. 736259Domain d1yarm1: 1yar M:1-203 [122849]
    Other proteins in same PDB: d1yara1, d1yarb1, d1yarc1, d1yard1, d1yare1, d1yarf1, d1yarg1
    automatically matched to d1pma1_
    complexed with gol, so4; mutant

Details for d1yarm1

PDB Entry: 1yar (more details), 1.9 Å

PDB Description: structure of archeabacterial 20s proteasome mutant d9s- pa26 complex
PDB Compounds: (M:) Proteasome beta subunit

SCOP Domain Sequences for d1yarm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yarm1 d.153.1.4 (M:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOP Domain Coordinates for d1yarm1:

Click to download the PDB-style file with coordinates for d1yarm1.
(The format of our PDB-style files is described here.)

Timeline for d1yarm1: