Lineage for d1yarf1 (1yar F:13-233)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735943Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 736028Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 736044Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56256] (4 PDB entries)
  8. 736050Domain d1yarf1: 1yar F:13-233 [122842]
    Other proteins in same PDB: d1yarh1, d1yari1, d1yarj1, d1yark1, d1yarl1, d1yarm1, d1yarn1
    automatically matched to d1pmaa_
    complexed with gol, so4; mutant

Details for d1yarf1

PDB Entry: 1yar (more details), 1.9 Å

PDB Description: structure of archeabacterial 20s proteasome mutant d9s- pa26 complex
PDB Compounds: (F:) Proteasome alpha subunit

SCOP Domain Sequences for d1yarf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yarf1 d.153.1.4 (F:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOP Domain Coordinates for d1yarf1:

Click to download the PDB-style file with coordinates for d1yarf1.
(The format of our PDB-style files is described here.)

Timeline for d1yarf1: