Lineage for d1yarc1 (1yar C:13-233)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 875859Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 875875Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56256] (6 PDB entries)
  8. 875878Domain d1yarc1: 1yar C:13-233 [122839]
    Other proteins in same PDB: d1yarh1, d1yari1, d1yarj1, d1yark1, d1yarl1, d1yarm1, d1yarn1, d1yaro1, d1yarp1, d1yarq1, d1yarr1, d1yars1, d1yart1, d1yaru1
    automatically matched to d1pmaa_
    complexed with gol, so4; mutant

Details for d1yarc1

PDB Entry: 1yar (more details), 1.9 Å

PDB Description: Structure of Archeabacterial 20S proteasome mutant D9S- PA26 complex
PDB Compounds: (C:) Proteasome alpha subunit

SCOP Domain Sequences for d1yarc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yarc1 d.153.1.4 (C:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOP Domain Coordinates for d1yarc1:

Click to download the PDB-style file with coordinates for d1yarc1.
(The format of our PDB-style files is described here.)

Timeline for d1yarc1: