Lineage for d1ya7k1 (1ya7 K:1-203)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876146Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56253] (6 PDB entries)
  8. 876157Domain d1ya7k1: 1ya7 K:1-203 [122800]
    Other proteins in same PDB: d1ya7a1, d1ya7b1, d1ya7c1, d1ya7d1, d1ya7e1, d1ya7f1, d1ya7g1, d1ya7o1, d1ya7p1, d1ya7q1, d1ya7r1, d1ya7s1, d1ya7t1, d1ya7u1
    automatically matched to d1pma1_
    complexed with gol, so4

Details for d1ya7k1

PDB Entry: 1ya7 (more details), 2.3 Å

PDB Description: Implications for interactions of proteasome with PAN and PA700 from the 1.9 A structure of a proteasome-11S activator complex
PDB Compounds: (K:) Proteasome beta subunit

SCOP Domain Sequences for d1ya7k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ya7k1 d.153.1.4 (K:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOP Domain Coordinates for d1ya7k1:

Click to download the PDB-style file with coordinates for d1ya7k1.
(The format of our PDB-style files is described here.)

Timeline for d1ya7k1: