Lineage for d1ya0b1 (1ya0 B:1-497)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775787Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
  6. 775864Protein SMG-7 [140843] (1 species)
  7. 775865Species Human (Homo sapiens) [TaxId:9606] [140844] (1 PDB entry)
    Uniprot Q92540 1-497
  8. 775867Domain d1ya0b1: 1ya0 B:1-497 [122786]
    automatically matched to 1YA0 A:1-497
    complexed with so4

Details for d1ya0b1

PDB Entry: 1ya0 (more details), 2.55 Å

PDB Description: Crystal structure of the N-terminal domain of human SMG7
PDB Compounds: (B:) SMG-7 transcript variant 2

SCOP Domain Sequences for d1ya0b1:

Sequence, based on SEQRES records: (download)

>d1ya0b1 a.118.8.1 (B:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}
mslqsaqylrqaevlkadmtdsklgpaevwtsrqalqdlyqkmlvtdleyaldkkveqdl
wnhafknqittlqgqaknranpnrsevqanlslfleaasgfytqllqelctvfnvdlpcr
vkssqlgiisnkqthtsaivkpqssscsyicqhclvhlgdiaryrnqtsqaesyyrhaaq
lvpsngqpynqlailasskgdhlttifyycrsiavkfpfpaastnlqkalskalesrdev
ktkwgvsdfikafikfhghvylsksleklsplrekleeqfkellfqkafnsqqlvhvtvi
nlfqlhhlrdfsneteqhtysqdeqlcwtqllalfmsflgilckcplqnesqeesynayp
lpavkvsmdwlrlrprvfqeavvderqyiwpwlisllnsfhpheedlssisatplpeefe
lqgflalrpsfrnldfskghqgitgdkegqqrrirqqrlisigkwiadnqprliqcenev
gkllfiteipeliledp

Sequence, based on observed residues (ATOM records): (download)

>d1ya0b1 a.118.8.1 (B:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}
mslqsaqylrqaevlkadmtdsklgpaevwtsrqalqdlyqkmlvtdleyaldkkveqdl
wnhafknqittlqgqaknranpnrsevqanlslfleaasgfytqllqelctvfnvdlpcp
qssscsyicqhclvhlgdiaryrnqtsqaesyyrhaaqlvpsngqpynqlailasskgdh
lttifyycrsiavkfpfpaastnlqkalskalesrdevktkwgvsdfikafikfhghvyl
sksleklsplrekleeqfkellfqkafnsqqlvhvtvinlfqlhhlrdfsneteqhtysq
deqlcwtqllalfmsflgilckcplqneesynayplpavkvsmdwlrlrprvfqeavvde
rqyiwpwlisllnsfhpheedlssisatplpeefelqgflalrpsfrnldfskkegqqrr
irqqrlisigkwiadnqprliqcenevgkllfiteipeliledp

SCOP Domain Coordinates for d1ya0b1:

Click to download the PDB-style file with coordinates for d1ya0b1.
(The format of our PDB-style files is described here.)

Timeline for d1ya0b1: