SCOPe 2.04: Domain d1y8xa1: 1y8x A:27-183

Lineage for d1y8xa1 (1y8x A:27-183)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), E2 M [TaxId:9606] [143058] (3 PDB entries)
   Uniprot P61081 27-183
   the extra N-terminal peptide, bound to the heterodimeric E1 enzyme for NEDD8, can be seen in the PDB entry 1tt5, chains E and F

8. Domain d1y8xa1: 1y8x A:27-183 [122769]
   Other proteins in same PDB: d1y8xb1

Details for d1y8xa1

PDB Entry: 1y8x, 2.4 Å

PDB Description: structural basis for recruitment of ubc12 by an e2-binding domain in nedd8's e1

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 M

SCOPe Domain Sequences for d1y8xa1:

Sequence; same for both SEQRES and ATOM records:

>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]}
asaaqlriqkdinelnlpktcdisfsdpddllnfklvicpdegfyksgkfvfsfkvgqgy
phdppkvkcetmvyhpnidlegnvclnilredwkpvltinsiiyglqylflepnpedpln
keaaevlqnnrrlfeqnvqrsmrggyigstyferclk

Timeline for d1y8xa1:

• d1y8xa1 first appeared in SCOP 1.73
  
• d1y8xa1 appears in SCOPe 2.03
  
• d1y8xa1 appears in SCOPe 2.05
  
• d1y8xa1 appears in the current release, SCOPe 2.08