SCOPe 2.07: Domain d1y8rc_: 1y8r C:

Lineage for d1y8rc_ (1y8r C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)

8. Domain d1y8rc_: 1y8r C: [122761]
   automated match to d1a5r__
   complexed with atp, mg, zn

Details for d1y8rc_

PDB Entry: 1y8r, 2.75 Å

PDB Description: sumo e1 activating enzyme sae1-sae2-sumo1-mg-atp complex

PDB Compounds: (C:) Ubiquitin-like protein SMT3C

SCOPe Domain Sequences for d1y8rc_:

Sequence; same for both SEQRES and ATOM records:

>d1y8rc_ d.15.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriad
nhtpkelgmeeedvievyqeqtgg

Timeline for d1y8rc_:

• d1y8rc_ first appeared in SCOP 1.73, called d1y8rc1
  
• d1y8rc_ appears in SCOPe 2.06
  
• d1y8rc_ appears in the current release, SCOPe 2.08