Lineage for d1y8id1 (1y8i D:1-146)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632362Species Horse (Equus caballus) [TaxId:9796] [46504] (10 PDB entries)
  8. 632371Domain d1y8id1: 1y8i D:1-146 [122751]
    Other proteins in same PDB: d1y8ia1, d1y8ic1
    automatically matched to d1g0bb_
    complexed with hem

Details for d1y8id1

PDB Entry: 1y8i (more details), 2.6 Å

PDB Description: Horse methemoglobin low salt, PH 7.0 (98% relative humidity)
PDB Compounds: (D:) hemoglobin beta chain

SCOP Domain Sequences for d1y8id1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8id1 a.1.1.2 (D:1-146) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOP Domain Coordinates for d1y8id1:

Click to download the PDB-style file with coordinates for d1y8id1.
(The format of our PDB-style files is described here.)

Timeline for d1y8id1: