SCOPe 2.03: Domain d1y8hb1: 1y8h B:1-146

Lineage for d1y8hb1 (1y8h B:1-146)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (16 PDB entries)

8. Domain d1y8hb1: 1y8h B:1-146 [122745]
   Other proteins in same PDB: d1y8ha1, d1y8hc1
   automatically matched to d1g0bb_
   complexed with hem

Details for d1y8hb1

PDB Entry: 1y8h, 3.1 Å

PDB Description: horse methemoglobin low salt, ph 7.0

PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1y8hb1:

Sequence; same for both SEQRES and ATOM records:

>d1y8hb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d1y8hb1:

• d1y8hb1 first appeared in SCOP 1.73
  
• d1y8hb1 appears in SCOPe 2.02
  
• d1y8hb1 is called d1y8hb_ in SCOPe 2.04
  
• d1y8hb1 appears in the current release, SCOPe 2.08, called d1y8hb_