SCOPe 2.08: Domain d1y7pa1: 1y7p A:79-217

Lineage for d1y7pa1 (1y7p A:79-217)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.7: AF1403 C-terminal domain-like [142040] (1 protein)

6. Protein Hypothetical protein AF1403, C-terminal domain [142041] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [142042] (1 PDB entry)
   Uniprot O28869 79-217

8. Domain d1y7pa1: 1y7p A:79-217 [122708]
   Other proteins in same PDB: d1y7pa2, d1y7pb2, d1y7pb3, d1y7pc2, d1y7pc3
   complexed with rip, zn

Details for d1y7pa1

PDB Entry: 1y7p, 1.9 Å

PDB Description: 1.9 a crystal structure of a protein of unknown function af1403 from archaeoglobus fulgidus, probable metabolic regulator

PDB Compounds: (A:) Hypothetical protein AF1403

SCOPe Domain Sequences for d1y7pa1:

Sequence; same for both SEQRES and ATOM records:

>d1y7pa1 c.23.1.7 (A:79-217) Hypothetical protein AF1403, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
sfervfgkrviilgggalvsqvaigaiseadrhnlrgerisvdtmpvvgeeeiaeavkav
srlhraevlvlaggimggkiteevkklrksgirvislsmfgsvpdvadvvisdpvmagtl
avmhisekakfdldrvkgr

Timeline for d1y7pa1:

• d1y7pa1 first appeared in SCOP 1.73
  
• d1y7pa1 appears in SCOPe 2.07