SCOPe 2.01: Domain d1y6ml_: 1y6m L:

Lineage for d1y6ml_ (1y6m L:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
   intertwined dimer, similar to interferon-gamma

7. Species Epstein-Barr virus [TaxId:10376] [47308] (3 PDB entries)

8. Domain d1y6ml_: 1y6m L: [122665]
   Other proteins in same PDB: d1y6mr1, d1y6mr2
   automated match to d1vlk__

Details for d1y6ml_

PDB Entry: 1y6m, 2.8 Å

PDB Description: crystal structure of epstein-barr virus il-10 complexed with the soluble il-10r1 chain

PDB Compounds: (L:) Viral interleukin-10 homolog

SCOPe Domain Sequences for d1y6ml_:

Sequence; same for both SEQRES and ATOM records:

>d1y6ml_ a.26.1.3 (L:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Epstein-Barr virus [TaxId: 10376]}
cdnfpqmlrdlrdafsrvktffqtkdevdnlllkeslledfkgylgcqalsemiqfylee
vmpqaenqdpeakdhvnslgenlktlrlrlrrchrflpcenkskaveqiknafnklqekg
iykamsefdifinyieaymtik

Timeline for d1y6ml_:

• d1y6ml_ first appeared in SCOP 1.73, called d1y6ml1
  
• d1y6ml_ was called d1y6ml1 in SCOP 1.75
  
• d1y6ml_ appears in SCOPe 2.02
  
• d1y6ml_ appears in the current release, SCOPe 2.08