Class a: All alpha proteins [46456] (258 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins) contains an additional helix in one of the crossover connections |
Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species) intertwined dimer, similar to interferon-gamma |
Species Epstein-Barr virus [TaxId:10376] [47308] (2 PDB entries) |
Domain d1y6ml1: 1y6m L:12-157 [122665] Other proteins in same PDB: d1y6mr1, d1y6mr2 automatically matched to d1vlk__ mutant |
PDB Entry: 1y6m (more details), 2.8 Å
SCOP Domain Sequences for d1y6ml1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y6ml1 a.26.1.3 (L:12-157) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Epstein-Barr virus [TaxId: 10376]} cdnfpqmlrdlrdafsrvktffqtkdevdnlllkeslledfkgylgcqalsemiqfylee vmpqaenqdpeakdhvnslgenlktlrlrlrrchrflpcenkskaveqiknafnklqekg iykamsefdifinyieaymtik
Timeline for d1y6ml1: